• Featured Product
  • KD/KO Validated

PICK1 Recombinant monoclonal antibody, PBS Only (Detector)

PICK1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 82919-1-PBS
Clone No.230185B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

230185B8, PICK, PRKCA binding protein, PRKCA-binding protein, PRKCABP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82919-1-PBS targets PICK1 as part of a matched antibody pair:

MP00068-3: 82919-2-PBS capture and 82919-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1443

Product name: Recombinant human PICK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-415 aa of BC017561

Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

Predict reactive species
Full Name protein interacting with PRKCA 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC017561
Gene Symbol PICK1
Gene ID (NCBI) 9463
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein interacting with C kinase 1 (PICK1) was first cloned as a PKC-binding partner through yeast two hybrid system. PICK1 acts as a critical regulator of membrane receptors' subcellular trafficking to modulate neural processes such as learning and memory, and is widely expressed in brain, testis, heart, lung, liver, kidney and muscle. It probably binds to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence, for instance, PICK1 is a critical mediator of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) trafficking in neural synapses. PICK1 expression on D-serine release and glutamate transport in astrocytes suggests a potential implication of PICK1 in the progression of amyotrophic lateral sclerosis (ALS). PICK1 may also participate in breast cancer development through inhibition of TGF-β signaling.

Loading...
||
New chat Able
正在加载,请稍候...