• Featured Product
  • KD/KO Validated

PICK1 Recombinant monoclonal antibody

PICK1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 82919-1-RR
Clone No.230185B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), ELISA

230185B8, PICK, PRKCA binding protein, PRKCA-binding protein, PRKCABP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, MCF-7 cells, mouse brain tissue, rat brain tissue, pig brain tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82919-1-RR targets PICK1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1443

Product name: Recombinant human PICK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-415 aa of BC017561

Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

Predict reactive species
Full Name protein interacting with PRKCA 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC017561
Gene Symbol PICK1
Gene ID (NCBI) 9463
RRIDAB_3670654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein interacting with C kinase 1 (PICK1) was first cloned as a PKC-binding partner through yeast two hybrid system. PICK1 acts as a critical regulator of membrane receptors' subcellular trafficking to modulate neural processes such as learning and memory, and is widely expressed in brain, testis, heart, lung, liver, kidney and muscle. It probably binds to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence, for instance, PICK1 is a critical mediator of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) trafficking in neural synapses. PICK1 expression on D-serine release and glutamate transport in astrocytes suggests a potential implication of PICK1 in the progression of amyotrophic lateral sclerosis (ALS). PICK1 may also participate in breast cancer development through inhibition of TGF-β signaling.

Protocols

Product Specific Protocols
FC protocol for PICK1 antibody 82919-1-RRDownload protocol
IHC protocol for PICK1 antibody 82919-1-RRDownload protocol
WB protocol for PICK1 antibody 82919-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...