CoraLite® Plus 488-conjugated PICK1 Monoclonal antibody

PICK1 Monoclonal Antibody for IF/ICC
Cat No. CL488-67099
Clone No.2E11A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Pig

Applications

IF/ICC

PICK, PICK1, PRKCA binding protein, PRKCABP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67099 targets PICK1 in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28609

Product name: Recombinant human PICK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-415 aa of BC017561

Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

Predict reactive species
Full Name protein interacting with PRKCA 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC017561
Gene Symbol PICK1
Gene ID (NCBI) 9463
RRIDAB_2919420
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Protein interacting with C kinase 1 (PICK1) was first cloned as a PKC-binding partner through yeast two hybrid system. PICK1 acts as a critical regulator of membrane receptors' subcellular trafficking to modulate neural processes such as learning and memory, and is widely expressed in brain, testis, heart, lung, liver, kidney and muscle. It probably binds to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence, for instance, PICK1 is a critical mediator of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) trafficking in neural synapses. PICK1 expression on D-serine release and glutamate transport in astrocytes suggests a potential implication of PICK1 in the progression of amyotrophic lateral sclerosis (ALS). PICK1 may also participate in breast cancer development through inhibition of TGF-β signaling.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PICK1 antibody CL488-67099Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...