PIG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIG3 Polyclonal antibody, PBS Only (14828-1-PBS)

• 

  WB analysis of HeLa using 14828-1-AP (same clone as 14828-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 14828-1-AP (same clone as 14828-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14828-1-AP (same clone as 14828-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 14828-1-AP (same clone as 14828-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14828-1-AP (same clone as 14828-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 14828-1-AP (same clone as 14828-1-PBS)

  IP result of anti-PIG3 (IP:14828-1-AP, 4ug; Detection:14828-1-AP 1:500) with MCF-7 cells lysate 3200ug. This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14828-1-AP (same clone as 14828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14828-1-AP (same clone as 14828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14828-1-AP (same clone as 14828-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIG3 antibody (14828-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 14828-1-PBS in a different storage buffer formulation.

PIG3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14828-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

14828-1-PBS targets PIG3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6618

  Product name: Recombinant human TP53I3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC000474

  Sequence: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

• Full Name: tumor protein p53 inducible protein 3
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC000474
• Gene Symbol: TP53I3
• Gene ID (NCBI): 9540
• RRID: AB_2206893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53FA7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.