PIGM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIGM Polyclonal antibody, PBS Only (20421-1-PBS)

• 

  WB analysis of HeLa using 20421-1-AP (same clone as 20421-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20421-1-AP (PIGM antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20421-1-AP (same clone as 20421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20421-1-AP (same clone as 20421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20421-1-AP (same clone as 20421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20421-1-AP (same clone as 20421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20421-1-AP (same clone as 20421-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 20421-1-AP (PIGM antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20421-1-PBS in a different storage buffer formulation.

PIGM Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20421-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20421-1-PBS targets PIGM in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14245

  Product name: Recombinant human PIGM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-299 aa of BC019865

  Sequence: VAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQL

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class M
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC019865
• Gene Symbol: PIGM
• Gene ID (NCBI): 93183
• RRID: AB_10734320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3S5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.