CoraLite® Plus 488-conjugated PIGR Polyclonal antibody

• 

  IF Staining of human small intestine using CL488-22024

  Immunofluorescent analysis of (4% PFA) fixed human small intestine tissue using CoraLite® Plus 488 PIGR antibody (CL488-22024) at dilution of 1:200.

• 

  IF Staining of mouse small intestine using CL488-22024

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using CoraLite® Plus 488 PIGR antibody (CL488-22024) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human small intestine using CL488-22024

  Immunofluorescent analysis of (4% PFA) fixed human small intestine tissue using CoraLite® Plus 488 PIGR antibody (CL488-22024) at dilution of 1:200.

PIGR Polyclonal Antibody for IF-P

Cat No. CL488-22024

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

Secretory component, Poly-Ig receptor, Poly Ig receptor, Hepatocellular carcinoma-associated protein TB6

---

Tested Applications

• Positive IF-P detected in: human small intestine tissue, mouse small intestine tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22024 targets PIGR in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16876

  Product name: Recombinant human PIGR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 289-638 aa of BC110494

  Sequence: RAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSR

• Full Name: polymeric immunoglobulin receptor
• Calculated Molecular Weight: 764 aa, 83 kDa
• GenBank Accession Number: BC110494
• Gene Symbol: PIGR
• Gene ID (NCBI): 5284
• RRID: AB_3084060
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: P01833
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.