PIGS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIGS Polyclonal antibody, PBS Only (18334-1-PBS)

• 

  WB analysis of HeLa using 18334-1-AP (same clone as 18334-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 18334-1-AP (same clone as 18334-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 18334-1-AP (same clone as 18334-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 18334-1-AP (same clone as 18334-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 18334-1-AP (same clone as 18334-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 18334-1-AP (same clone as 18334-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIGS antibody (18334-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 18334-1-PBS in a different storage buffer formulation.

PIGS Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 18334-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

UNQ1873/PRO4316, Phosphatidylinositol-glycan biosynthesis class S protein, GPI transamidase component PIG-S

---

Product Information

18334-1-PBS targets PIGS in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12950

  Product name: Recombinant human PIGS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 313-555 aa of BC001319

  Sequence: SSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIFLETRKSWRKPEKTD

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class S
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001319
• Gene Symbol: PIGS
• Gene ID (NCBI): 94005
• RRID: AB_2878532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96S52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PIGS, also named as GPI transamidase component PIG-S or PRO4316, is a 555 amino acid protein, which belongs to the PIGS family. PIGS localizes in the endoplasmic reticulum membrane. PIGS is a component of the GPI transamidase complex. It is essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates.