VPS34 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• VPS34 Recombinant monoclonal antibody, PBS Only (Capture) (87952-1-PBS)

VPS34 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Cytometric bead array, Indirect ELISA

Cat No. 87952-1-PBS

Clone No.260118B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Cytometric bead array, Indirect ELISA

Synonyms

PIK3C3, EC:2.7.1.137, hVps34, PI 3 Kinase Class 3, PI 3-kinase p100

• 

  WB analysis using 87952-1-RR (same clone as 87952-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87952-1-RR (PIK3C3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87952-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of PC-3 using 87952-1-RR (same clone as 87952-1-PBS)

  IP result of anti-VPS34 (IP:87952-1-RR, 4ug; Detection:87952-1-RR 1:800) with PC-3 cells lysate 960 ug. This data was developed using the same antibody clone with 87952-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 87952-1-RR (same clone as 87952-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 87952-1-RR (VPS34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87952-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 87952-1-RR (same clone as 87952-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 87952-1-RR (VPS34 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87952-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03292-1

  The mean VPS34 concentration was determined to be 54.5 ng/mL in Hela cell extract based on a 1.2 mg/mL extract load, 15.6 ng/mL in PC-3 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03292-1

  Cytometric bead array standard curve of MP03292-1, VPS34 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87952-1-PBS. Detection antibody: 87952-2-PBS. Standard: Ag3110. Range: 0.312-40 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87952-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87952-1-RR against Human VPS34 were performed. The affinity constant is 0.547 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87952-1-PBS targets VPS34 as part of a matched antibody pair:

MP03292-1: 87952-1-PBS capture and 87952-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3110

  Product name: Recombinant human PIK3C3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-887 aa of BC033004

  Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

• Full Name: phosphoinositide-3-kinase, class 3
• Calculated Molecular Weight: 887 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC033004
• Gene Symbol: VPS34
• Gene ID (NCBI): 5289
• RRID: AB_3745836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NEB9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and belongs to the PI3/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072).