VPS34 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• VPS34 Recombinant monoclonal antibody (87952-1-RR)

VPS34 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA

Cat No. 87952-1-RR

Clone No.260118B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PIK3C3, EC:2.7.1.137, hVps34, PI 3 Kinase Class 3, PI 3-kinase p100

• 

  WB analysis using 87952-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87952-1-RR (PIK3C3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of PC-3 using 87952-1-RR

  IP result of anti-VPS34 (IP:87952-1-RR, 4ug; Detection:87952-1-RR 1:800) with PC-3 cells lysate 960 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 87952-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 87952-1-RR (VPS34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 87952-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 87952-1-RR (VPS34 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87952-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87952-1-RR against Human VPS34 were performed. The affinity constant is 0.547 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: PC-3 cells, HepG2 cells, Raji cells, Jurkat cells, mouse brain tissue, rat brain tissue, mouse testis tissue
• Positive IP detected in: PC-3 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87952-1-RR targets VPS34 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3110

  Product name: Recombinant human PIK3C3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-887 aa of BC033004

  Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

• Full Name: phosphoinositide-3-kinase, class 3
• Calculated Molecular Weight: 887 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC033004
• Gene Symbol: VPS34
• Gene ID (NCBI): 5289
• RRID: AB_3745836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NEB9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and belongs to the PI3/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072).