Product Information
27196-1-PBS targets PIM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25743 Product name: Recombinant human PIM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 244-313 aa of BC020224 Sequence: HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK Predict reactive species |
| Full Name | pim-1 oncogene |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 30-40 kDa |
| GenBank Accession Number | BC020224 |
| Gene Symbol | PIM1 |
| Gene ID (NCBI) | 5292 |
| RRID | AB_3742218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11309 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PIM1 belongs to the Ser/Thr protein kinase family and the Pim subfamily. This family includes PIM1, PIM2, and PIM3, which share high sequence and structural similarity. PIM1 is a serine/threonine protein kinase that significantly promotes cell survival and proliferation, providing a selective advantage for tumorigenesis. PIM1 is expressed primarily in cells of the hematopoietic and germline lineages (PMID: 16186805).

