PIM3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIM3 Polyclonal antibody, PBS Only (33202-1-PBS)

• 

  WB analysis using 33202-1-AP (same clone as 33202-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33202-1-AP (PIM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33202-1-PBS in a different storage buffer formulation.

PIM3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33202-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

pim 3, pim 3 oncogene

---

Product Information

33202-1-PBS targets PIM3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39664

  Product name: Recombinant human PIM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-326 aa of BC141855

  Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL

• Full Name: pim-3 oncogene
• Calculated Molecular Weight: 326 aa, 36 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC141855
• Gene Symbol: PIM3
• Gene ID (NCBI): 415116
• RRID: AB_3742893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86V86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.