PITPNM2/NIR3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PITPNM2/NIR3 Polyclonal antibody, PBS Only (21169-1-PBS)

• 

  IHC staining of human placenta using 21169-1-AP (same clone as 21169-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21169-1-AP (PITPNM2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21169-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 21169-1-AP (same clone as 21169-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 21169-1-AP (PITPNM2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21169-1-PBS in a different storage buffer formulation.

PITPNM2/NIR3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21169-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

PITPNM2, KIAA1457, Membrane-associated phosphatidylinositol transfer protein 2, NIR3, NIR-3

---

Product Information

21169-1-PBS targets PITPNM2/NIR3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15385

  Product name: Recombinant human PITPNM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 233-328 aa of BC141813

  Sequence: EWYGLSMENIRELEKEAQLMLSRKMAQFNEDGEEATELVKHEAVSDQTSGEPPEPSSSNGEPLVGRGLKKQWSTSSKSSRSSKRGASPSRHSISEW

• Full Name: phosphatidylinositol transfer protein, membrane-associated 2
• Calculated Molecular Weight: 1349 aa, 149 kDa
• GenBank Accession Number: BC141813
• Gene Symbol: PITPNM2
• Gene ID (NCBI): 57605
• RRID: AB_3742019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZ72
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PITPNM2, also known as NIR3, belongs to a family of membrane-associated phosphatidylinositol transfer domain-containing proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein(PMID: 15627748). PITPNM2/NIR3 promotes both TCRβ selection and positive selection in thymocytes. PITPNM2/NIR3 is required for PIP2 replenishment and TCR-induced calcium signaling in response to weak TCR stimulation(PMID: 36581712).