PITRM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PITRM1 Polyclonal antibody, PBS Only (30674-1-PBS)

• 

  WB analysis using 30674-1-AP (same clone as 30674-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30674-1-AP (PITRM1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 30674-1-AP (same clone as 30674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 30674-1-AP (PITRM1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 30674-1-AP (same clone as 30674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 30674-1-AP (PITRM1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30674-1-PBS in a different storage buffer formulation.

PITRM1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30674-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30674-1-PBS targets PITRM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30478

  Product name: Recombinant human PITRM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 258-410 aa of BC001150

  Sequence: ILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLS

• Full Name: pitrilysin metallopeptidase 1
• Calculated Molecular Weight: 60 kDa, 117 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC001150
• Gene Symbol: PITRM1
• Gene ID (NCBI): 10531
• RRID: AB_3086385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JRX3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PITRM1 (Presequence protease, mitochondrial) is a ATP-independent protease that degrades mitochondrial transit peptides after their cleavage.It is specific for peptides in the range of 10 to 65 residues.and able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease.It shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference(PMID:16849325).This protein has a calculated molecular mass of 117kD and it is expressed widely.