PITX1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PITX1 Recombinant monoclonal antibody, PBS Only (88143-1-PBS)

PITX1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88143-1-PBS

Clone No.260497B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BFT, Hindlimb-expressed homeobox protein backfoot, Paired-like homeodomain transcription factor 1, POTX, PTX1

• 

  WB analysis using 88143-1-RR (same clone as 88143-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88143-1-RR (PITX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88143-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88143-1-PBS targets PITX1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1303

  Product name: Recombinant human PITX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-314 aa of BC009412

  Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

• Full Name: paired-like homeodomain 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC009412
• Gene Symbol: PITX1
• Gene ID (NCBI): 5307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78337
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PITX1 (Paired-like homeodomain 1) is a bicoid-related homeobox transcription factor that plays critical roles in embryonic development, particularly in patterning the hindlimb and regulating pituitary organogenesis. It is also known as "Backfoot" due to its involvement in establishing left-right asymmetry during limb formation. Beyond development, PITX1 has been implicated in various cancers, where it can function as either a tumor suppressor or an oncogene depending on the cellular context, and its dysregulation is associated with tumor progression and metastasis.