PITX1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PITX1 Recombinant monoclonal antibody (88143-1-RR)

PITX1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88143-1-RR

Clone No.260497B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BFT, Hindlimb-expressed homeobox protein backfoot, Paired-like homeodomain transcription factor 1, POTX, PTX1

• 

  WB analysis using 88143-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88143-1-RR (PITX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88143-1-RR targets PITX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1303

  Product name: Recombinant human PITX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-314 aa of BC009412

  Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

• Full Name: paired-like homeodomain 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC009412
• Gene Symbol: PITX1
• Gene ID (NCBI): 5307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78337
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PITX1 (Paired-like homeodomain 1) is a bicoid-related homeobox transcription factor that plays critical roles in embryonic development, particularly in patterning the hindlimb and regulating pituitary organogenesis. It is also known as "Backfoot" due to its involvement in establishing left-right asymmetry during limb formation. Beyond development, PITX1 has been implicated in various cancers, where it can function as either a tumor suppressor or an oncogene depending on the cellular context, and its dysregulation is associated with tumor progression and metastasis.