CoraLite® Plus 647-conjugated PKC Gamma Polyclonal antibody

• 

  WB analysis using CL647-14364

  Various lysates were subjected to SDS PAGE followed by western blot with CL647-14364 (PKC Gamma antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PKC Gamma Polyclonal Antibody for WB

Cat No. CL647-14364

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB

Synonyms

PKC gamma, PKCC, PKCG, PRKCG, Protein kinase C gamma type, protein kinase C, gamma, SCA14

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-14364 targets PKC Gamma in WB applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5681

  Product name: Recombinant human PRKCG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-697 aa of BC047876

  Sequence: FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

• Full Name: protein kinase C, gamma
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 76-80 kDa
• GenBank Accession Number: BC047876
• Gene Symbol: PKC Gamma
• Gene ID (NCBI): 5582
• RRID: AB_2920225
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05129
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC gamma is a neuron-specific member of the classical PKCs and is activated and translocated to subcellular regions as a result of various stimuli, including diacylglycerol synthesis, increased intracellular Ca(2+) and phorbol esters. Defects in this protein have been associated with spinocerebellar ataxia type 14 (SCA14), an autosomal dominant neurodegenerative disease.