PKC Iota Monoclonal antibody, PBS Only

• 

  WB analysis using 66493-1-Ig (same clone as 66493-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC Iota antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66493-1-Ig (same clone as 66493-1-PBS)

  WB result of PKC Iota antibody (66493-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKC Iota transfected HeLa cells. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66493-1-Ig (same clone as 66493-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC iota antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66493-1-Ig (same clone as 66493-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC iota antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66493-1-Ig (same clone as 66493-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC iota antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 66493-1-Ig (same clone as 66493-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC iota antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 66493-1-Ig (same clone as 66493-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 66493-1-Ig (PKC iota antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66493-1-Ig (same clone as 66493-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66493-1-Ig (PKC iota antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66493-1-Ig (same clone as 66493-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66493-1-Ig (PKC iota antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human lung cancer using 66493-1-Ig (same clone as 66493-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using PKC Iota antibody (66493-1-Ig, Clone: 3A1B6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66493-1-Ig (same clone as 66493-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PKC Iota antibody (66493-1-Ig, Clone: 3A1B6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66493-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PKC Iota Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 66493-1-PBS

Clone No.3A1B6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

PRKCI, 3A1B6, aPKC lambda/iota, aPKC-lambda/iota, Atypical protein kinase C-lambda/iota

---

Product Information

66493-1-PBS targets PKC Iota in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4990

  Product name: Recombinant human PRKCI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-587 aa of BC022016

  Sequence: SSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

• Full Name: protein kinase C, iota
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC022016
• Gene Symbol: PKC Iota
• Gene ID (NCBI): 5584
• RRID: AB_2881858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41743
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The atypical protein kinase C isoform PRKC iota (PRKCI) is a member of the protein kinase C (PKC) family of serine/threonine protein kinases. PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. PRKC iota is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. PRKC iota plays a key role in cell proliferation, differentiation, and carcinogenesis, and it has been shown to be a human oncogene.