PKC eta Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PKC eta Polyclonal antibody (26916-1-AP)

• 

  WB analysis of Jurkat using 26916-1-AP

  WB result of PKC eta antibody (26916-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKC eta transfected Jurkat cells.

• 

  WB analysis using 26916-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26916-1-AP (PKC eta antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• KD/KO Validated

PKC eta Polyclonal Antibody for WB, ELISA

Cat No. 26916-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PRKCH, PKC L, PKCL, PRKCL, Protein kinase C eta type

---

Tested Applications

• Positive WB detected in: PC-3 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26916-1-AP targets PKC eta in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25365

  Product name: Recombinant human PRKCH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 634-683 aa of BC037268

  Sequence: RIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP

• Full Name: protein kinase C, eta
• Observed Molecular Weight: 75-90 kDa
• GenBank Accession Number: BC037268
• Gene Symbol: PRKCH
• Gene ID (NCBI): 5583
• RRID: AB_3742204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24723
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKCH (gene ID: 5583) encodes protein kinase C eta (PKCη), a calcium‑independent, phospholipid‑dependent serine/threonine kinase of the novel PKC subfamily. It regulates cell proliferation, differentiation, and apoptosis, with prominent roles in keratinocyte differentiation, early B‑cell development, and epithelial barrier integrity. Genetic variants in PRKCH are linked to cerebral infarction and Alzheimer's disease, while PKCη exhibits context‑dependent functions in cancer-promoting progression and chemoresistance in some tumors (e.g., glioblastoma) but acting as a tumor suppressor in others (e.g., hepatocellular carcinoma).