PKD2L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PKD2L1 Polyclonal antibody, PBS Only (13117-2-PBS)

• 

  WB analysis of human liver using 13117-2-AP (same clone as 13117-2-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13117-2-AP (PKD2L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13117-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13117-2-AP (same clone as 13117-2-PBS)

  WB result of PKD2L1 antibody (13117-2-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKD2L1 transfected HepG2 cells. This data was developed using the same antibody clone with 13117-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PKD2L1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13117-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13117-2-PBS targets PKD2L1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3807

  Product name: Recombinant human PKD2L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-805 aa of BC025665

  Sequence: NDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS

• Full Name: polycystic kidney disease 2-like 1
• Calculated Molecular Weight: 805 aa, 92 kDa
• Observed Molecular Weight: 75-85 kDa, 92 kDa
• GenBank Accession Number: BC025665
• Gene Symbol: PKD2L1
• Gene ID (NCBI): 9033
• RRID: AB_2163481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.