PKIA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PKIA Polyclonal antibody, PBS Only (11743-1-PBS)

• 

  IHC staining of mouse embryo using 11743-1-AP (same clone as 11743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 11743-1-AP (PKIA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 11743-1-AP (same clone as 11743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 11743-1-AP (PKIA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11743-1-AP (same clone as 11743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11743-1-AP (PKIA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11743-1-AP (same clone as 11743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11743-1-AP (PKIA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11743-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11743-1-AP (same clone as 11743-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PKIA antibody (11743-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11743-1-PBS in a different storage buffer formulation.

PKIA Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 11743-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11743-1-PBS targets PKIA in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2338

  Product name: Recombinant human PKIA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC022265

  Sequence: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES

• Full Name: protein kinase (cAMP-dependent, catalytic) inhibitor alpha
• Calculated Molecular Weight: 76 aa, 8 kDa
• GenBank Accession Number: BC022265
• Gene Symbol: PKIA
• Gene ID (NCBI): 5569
• RRID: AB_3085380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

cAMP-dependent protein kinase inhibitor alpha (PKIA) is also named as PRKACN1, and belongs to the PKI family. Among them, PKIA, a member of protein kinase A (PKA) inhibitor family, was found to be most significantly and highly expressed in susceptible animals (PMID:24910983). Decreased PKIA signaling would directly impact PKA activation, potentially inducing DRP1 phosphorylation and increasing ER Ca2+ stores (PMID:32152556). miR-129-5p activated PKA to regulate the phosphorylation of beta-catenin and cAMP-response element binding protein (CREB) by inhibiting PKIA (PMID:36222334).