Filter: AllWBIF/ICC

WB analysis of mouse heart using 21371-1-AP (same clone as 21371-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 21371-1-AP (PKIG antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21371-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 21371-1-AP (same clone as 21371-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 21371-1-AP (PKIG antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21371-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 21371-1-AP (same clone as 21371-1-PBS)
Immunofluorescent analysis of Hela cells, using PKIG antibody 21371-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 21371-1-PBS in a different storage buffer formulation.

PKIG Polyclonal antibody, PBS Only

Name: PKIG Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21371-1-PBS

PKIG Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21371-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

cAMP-dependent protein kinase inhibitor gamma, PKI gamma, PKI-gamma

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

21371-1-PBS targets PKIG in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15878 Product name: Recombinant human PKIG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC104257 Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS Predict reactive species
Full Name	protein kinase (cAMP-dependent, catalytic) inhibitor gamma
Calculated Molecular Weight	76 aa, 8 kDa
Observed Molecular Weight	5-8 kDa
GenBank Accession Number	BC104257
Gene Symbol	PKIG
Gene ID (NCBI)	11142
RRID	AB_10858922
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y2B9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™