PKNOX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PKNOX2 Polyclonal antibody, PBS Only (20352-1-PBS)

• 

  WB analysis of RAW264.7 using 20352-1-AP (same clone as 20352-1-PBS)

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20352-1-AP (same clone as 20352-1-PBS)

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20352-1-AP (same clone as 20352-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 20352-1-AP (same clone as 20352-1-PBS)

  Mouse lung tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 20352-1-AP (same clone as 20352-1-PBS)

  Human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20352-1-AP (same clone as 20352-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20352-1-AP (PKNOX2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20352-1-AP (same clone as 20352-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20352-1-AP (PKNOX2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20352-1-PBS in a different storage buffer formulation.

PKNOX2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20352-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Homeobox protein PREP-2, PREP2

---

Product Information

20352-1-PBS targets PKNOX2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14195

  Product name: Recombinant human PKNOX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-471 aa of BC045626

  Sequence: MLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMEEEEEELEEEVDELQTTNVSDLGLEHSDSLE

• Full Name: PBX/knotted 1 homeobox 2
• Calculated Molecular Weight: 472 aa, 52 kDa
• Observed Molecular Weight: 70 kDa, 55 kDa
• GenBank Accession Number: BC045626
• Gene Symbol: PKNOX2
• Gene ID (NCBI): 63876
• RRID: AB_10694277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PKNOX2, PBX/knotted 1 homeobox 2, also named as PREP2, belongs to the three-amino acid loop extension (TALE) homeobox family. As it contains a DNA-binding motif, PKNOX2 may function as a nuclear transcription factor, experiments have reported the PKNOX2 protein locates to the nucleus. It was showed that highest expression of a 4-kb PREP2 (PKNOX2) transcript in heart, brain, skeletal muscle, and ovary(PMID:11972344). Several years later, PKNOX2 was identified as one of the cis-regulated genes for alcohol addiction in mice, however it has not been reported to be associated with any similar phenotype in humans to date (PMID:19721000). The molecular weight of the protein may differ from the theoretical value.