PLA2G12A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLA2G12A Polyclonal antibody, PBS Only (16009-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 16009-1-AP (same clone as 16009-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16009-1-AP (same clone as 16009-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 16009-1-AP (same clone as 16009-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 16009-1-AP (same clone as 16009-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 16009-1-AP (same clone as 16009-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 16009-1-AP (same clone as 16009-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16009-1-AP (PLA2G12A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 16009-1-AP (same clone as 16009-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 16009-1-AP (PLA2G12A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 16009-1-AP (same clone as 16009-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 16009-1-AP (PLA2G12A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 16009-1-AP (same clone as 16009-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 16009-1-AP (PLA2G12A Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 16009-1-AP (same clone as 16009-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 16009-1-AP (PLA2G12A Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 16009-1-AP (same clone as 16009-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 16009-1-AP (PLA2G12A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16009-1-PBS in a different storage buffer formulation.

PLA2G12A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16009-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16009-1-PBS targets PLA2G12A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8722

  Product name: Recombinant human PLA2G12A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-189 aa of BC017218

  Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

• Full Name: phospholipase A2, group XIIA
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 21-24 kDa
• GenBank Accession Number: BC017218
• Gene Symbol: PLA2G12A
• Gene ID (NCBI): 81579
• RRID: AB_2164314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLA2G12A (or PLA2G12) gene encodes group XII secreted phospholipase A2 (sPLA2) which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Cellular arachidonate (AA) release and prostaglandin (PG) production is regulated by sPLA(2)s, groups III and XII. Group XII sPLA2 have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. Cells transfected with group XII sPLA(2) exhibited abnormal morphology, suggesting a unique functional aspect of this enzyme. Role of sPLA2s as potential tumour biomarkers and therapeutic targets for various cancers have been reported.