iPLA2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• iPLA2 Polyclonal antibody (22030-1-AP)

iPLA2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 22030-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

PLA2G6, 2-lysophosphatidylcholine acylhydrolase, 85/88 kDa calcium-independent phospholipase A2, CaI PLA2, CaI-PLA2

• 

  WB analysis of mouse testis using 22030-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22030-1-AP (iPLA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 22030-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22030-1-AP (iPLA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 22030-1-AP

  IP result of anti-iPLA2 (IP:22030-1-AP, 4ug; Detection:22030-1-AP 1:800) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 22030-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 22030-1-AP (iPLA2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 22030-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 22030-1-AP (iPLA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 22030-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 22030-1-AP (iPLA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 22030-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 22030-1-AP (iPLA2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 22030-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 22030-1-AP (iPLA2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for iPLA2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse small intestine tissue, human brain tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22030-1-AP targets iPLA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16896

  Product name: Recombinant human PLA2G6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC036742

  Sequence: MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANA

• Full Name: phospholipase A2, group VI (cytosolic, calcium-independent)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC036742
• Gene Symbol: PLA2G6
• Gene ID (NCBI): 8398
• RRID: AB_2878976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60733
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLA2G6, also named as PLPLA9, is involved in the remodeling of membranes allowing arachidonic acid to be placed in the proper position in phospholipids for stimulated release. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. This protein has 4 isoforms produced by alternative splicing.

Publications

What published studies show

The iPLA2 Polyclonal antibody (Cat# 22030-1-AP) has 13 published citations across journals including Nature Communications, Autophagy, Signal Transduction and Targeted Therapy, Theranostics, Advanced Science, Cell Reports, Experimental Neurology, and Molecules. Research fields span cancer (breast, liver, glioma, colorectal, thyroid, cervical), neurodegeneration (Parkinson's disease, neuroaxonal dystrophy), phospholipid metabolism, ferroptosis, psoriasis, neuropathic pain, traumatic brain injury, and colitis-associated carcinogenesis.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Signal Transduct Target Ther; Spatiotemporally programmed nanomedicine engineering to resolve conflicting immunosignals in triple-negative breast cancer.; Authors - Xiuping Guo
human,mouse	WB	Autophagy; ATG9A-PLA2G6 axis reprograms phospholipid metabolism to drive metabolic liver disease and hepatocellular carcinoma.; Authors - Qi Zhu
mouse	IP,IF	Nat Commun; Parkinson's disease-associated PLA2G6 protects IP3R1 protein to control ER-mitochondria tethering and Ca(2+) transfer.; Authors - Zhi-Hao Lin
human	WB,IHC	Theranostics; Ferritin light chain promotes the reprogramming of glioma immune microenvironment and facilitates glioma progression; Authors - Hongjiang Li
	WB	Adv Sci (Weinh); Role of SLC16A10 in Psoriasis Through the Regulation of Arachidonic Acid Metabolism in Keratinocytes; Authors - Jingyuan Yang
human	WB	Cell Rep; Alpha synuclein determines ferroptosis sensitivity in dopaminergic neurons via modulation of ether-phospholipid membrane composition; Authors - Laura Mahoney-Sanchez