PLAC1L Polyclonal antibody

• 

  WB analysis of human placenta using 17343-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 17343-1-AP (PLAC1L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary using 17343-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 17343-1-AP (PLAC1L Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 17343-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 17343-1-AP (PLAC1L Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary cancer using 17343-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 17343-1-AP (PLAC1L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 17343-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17343-1-AP (PLAC1L Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 17343-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17343-1-AP (PLAC1L Antibody) at dilution of 1:50 (under 40x lens).

PLAC1L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17343-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

TMEM122, Protein TMEM122, Placenta-specific 1-like protein, placenta 1 like, OOSP2

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

17343-1-AP targets PLAC1L in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11384

  Product name: Recombinant human PLAC1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC036256

  Sequence: MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL

• Full Name: placenta-specific 1-like
• Calculated Molecular Weight: 158 aa, 18 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC036256
• Gene Symbol: PLAC1L
• Gene ID (NCBI): 219990
• RRID: AB_2878391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WS3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAC1L, also named as TMEM122, is placenta specific protein. It is trophoblastic giant cells stain. The MW of PLAC1L is 16-18 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Neuroinflammation; The effect of dipeptidyl peptidase IV on disease-associated microglia phenotypic transformation in epilepsy.; Authors - Zhicheng Zheng
human	IF	Nat Commun; Single-cell transcriptome and translatome dual-omics reveals potential mechanisms of human oocyte maturation; Authors - Wenqi Hu