PLAC1L Polyclonal antibody

PLAC1L Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17343-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

TMEM122, Protein TMEM122, Placenta-specific 1-like protein, placenta 1 like, OOSP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17343-1-AP targets PLAC1L in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11384

Product name: Recombinant human PLAC1L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-158 aa of BC036256

Sequence: MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL

Predict reactive species
Full Name placenta-specific 1-like
Calculated Molecular Weight 158 aa, 18 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC036256
Gene Symbol PLAC1L
Gene ID (NCBI) 219990
RRIDAB_2878391
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86WS3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAC1L, also named as TMEM122, is placenta specific protein. It is trophoblastic giant cells stain. The MW of PLAC1L is 16-18 kDa.

Protocols

Product Specific Protocols
IHC protocol for PLAC1L antibody 17343-1-APDownload protocol
WB protocol for PLAC1L antibody 17343-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Neuroinflammation

The effect of dipeptidyl peptidase IV on disease-associated microglia phenotypic transformation in epilepsy.

Authors - Zhicheng Zheng
humanIF

Nat Commun

Single-cell transcriptome and translatome dual-omics reveals potential mechanisms of human oocyte maturation

Authors - Wenqi Hu
Loading...
||
New chat Able
正在加载,请稍候...