PLAC8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLAC8 Polyclonal antibody (12284-1-AP)

• Featured Product
• KD/KO Validated

PLAC8 Polyclonal Antibody for WB, ELISA

Cat No. 12284-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

BM-004, C15, onzin, placenta 8, Placenta-specific gene 8 protein

• 

  WB analysis of human peripheral blood leukocyte using 12284-1-AP

  human peripheral blood leukocyte were subjected to SDS PAGE followed by western blot with 12284-1-AP (PLAC8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12284-1-AP (PLAC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12284-1-AP (PLAC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLAC8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, human peripheral blood leukocyte, PANC-1 cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12284-1-AP targets PLAC8 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2939

  Product name: Recombinant human PLAC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC012205

  Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

• Full Name: placenta-specific 8
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC012205
• Gene Symbol: PLAC8
• Gene ID (NCBI): 51316
• RRID: AB_11182285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. The MW of PLAC8 is about 12-20kd.

Publications

What published studies show

The PLAC8 Polyclonal antibody (Cat# 12284-1-AP) has 9 citations spanning journals including Cancer Letters, Cell Communication and Signaling, Frontiers in Immunology, Communications Biology, FASEB Journal, PLoS Genetics, International Journal of Medical Sciences, and Histochemistry and Cell Biology. Research fields cover glioblastoma and temozolomide resistance, monocyte exhaustion, interstitial cystitis biomarkers, colorectal cancer metastasis, pulmonary fibrosis and autophagy, trophoblast biology, placental site trophoblastic tumor, and cervical cancer.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,CoIP	Cancer Lett; Aberrant PLAC8 expression characterizes glioblastoma with temozolomide resistance and an immunosuppressive microenvironment; Authors - Han She
mouse	WB	Cell Commun Signal; Propagation of monocyte exhaustion memory and underlying mechanisms.; Authors - Jing Wang
human	WB,IHC	Front Immunol; Identification and validation of immune and diagnostic biomarkers for interstitial cystitis/painful bladder syndrome by integrating bioinformatics and machine-learning; Authors - Tao Zhou
human	IHC	Front Immunol; Targeting the CCL28-STAT3-PLAC8 axis to suppress metastasis and remodel tumor microenvironment in colorectal cancer.; Authors - Yao Yang
human,mouse	WB,CoIP	Commun Biol; PLAC8 attenuates pulmonary fibrosis and inhibits apoptosis of alveolar epithelial cells via facilitating autophagy; Authors - Wei Sun
human	IHC	FASEB J; PLAC8 promotes the autophagic activity and improves the growth priority of human trophoblast cells.; Authors - Xuan Feng