Home
Products
Primary Antibodies
PLAC8 Polyclonal antibody, PBS Only (12284-1-PBS)

Filter: AllWBIHC

WB analysis of human peripheral blood leukocyte using 12284-1-AP (same clone as 12284-1-PBS)
human peripheral blood leukocyte were subjected to SDS PAGE followed by western blot with 12284-1-AP (PLAC8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
WB analysis using 12284-1-AP (same clone as 12284-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 12284-1-AP (PLAC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12284-1-AP (PLAC8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12284-1-AP (PLAC8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12284-1-AP (PLAC8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12284-1-AP (PLAC8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12284-1-AP (PLAC8 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12284-1-AP (same clone as 12284-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12284-1-AP (PLAC8 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12284-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PLAC8 Polyclonal antibody, PBS Only

Name: PLAC8 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 12284-1-PBS

PLAC8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12284-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

BM-004, C15, onzin, placenta 8, Placenta-specific gene 8 protein

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12284-1-PBS targets PLAC8 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2939 Product name: Recombinant human PLAC8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC012205 Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF Predict reactive species
Full Name	placenta-specific 8
Calculated Molecular Weight	12 kDa
Observed Molecular Weight	12 kDa
GenBank Accession Number	BC012205
Gene Symbol	PLAC8
Gene ID (NCBI)	51316
RRID	AB_11182285
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NZF1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. The MW of PLAC8 is about 12-20kd.