PLAG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLAG1 Polyclonal antibody, PBS Only (18018-1-PBS)

• 

  WB analysis of A431 using 18018-1-AP (same clone as 18018-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 18018-1-AP (PLAG1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18018-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 18018-1-AP (same clone as 18018-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18018-1-AP (PLAG1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18018-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 18018-1-AP (same clone as 18018-1-PBS)

  IP result of anti-PLAG1 (IP:18018-1-AP, 4ug; Detection:18018-1-AP 1:300) with HepG2 cells lysate 2400ug. This data was developed using the same antibody clone with 18018-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 18018-1-AP (same clone as 18018-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 18018-1-AP (PLAG1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18018-1-PBS in a different storage buffer formulation.

PLAG1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 18018-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

18018-1-PBS targets PLAG1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12566

  Product name: Recombinant human PLAG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 151-500 aa of BC075047

  Sequence: TCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ

• Full Name: pleiomorphic adenoma gene 1
• Calculated Molecular Weight: 500 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC075047
• Gene Symbol: PLAG1
• Gene ID (NCBI): 5324
• RRID: AB_2878482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6DJT9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.