PLCG2 Monoclonal antibody, PBS Only

• 

  WB analysis of Ramos using 67011-1-Ig (same clone as 67011-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 67011-1-Ig (PLCG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Karpas-422 using 67011-1-Ig (same clone as 67011-1-PBS)

  Karpas-422 cells were subjected to SDS PAGE followed by western blot with 67011-1-Ig (PLCG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit spleen using 67011-1-Ig (same clone as 67011-1-PBS)

  Rabbit spleen tissue was subjected to SDS PAGE followed by western blot with 67011-1-Ig (PLCG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67011-1-Ig (same clone as 67011-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67011-1-Ig (PLCG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67011-1-Ig (same clone as 67011-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67011-1-Ig (PLCG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67011-1-Ig (same clone as 67011-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67011-1-Ig (PLCG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67011-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PLCG2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67011-1-PBS

Clone No.2F8H5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2, 2F8H5, EC:3.1.4.11, Phosphoinositide phospholipase C-gamma-2, Phospholipase C gamma 2

---

Product Information

67011-1-PBS targets PLCG2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24355

  Product name: Recombinant human PLCG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 150-313 aa of BC007565

  Sequence: IYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQD

• Full Name: phospholipase C, gamma 2 (phosphatidylinositol-specific)
• Calculated Molecular Weight: 148 kDa
• Observed Molecular Weight: 148 kDa
• GenBank Accession Number: BC007565
• Gene Symbol: PLCG2
• Gene ID (NCBI): 5336
• RRID: AB_2882328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16885
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phospholipase C-gamma2 (PLCG2) is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor.IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.