PLCH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLCH1 Polyclonal antibody (19143-1-AP)

PLCH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19143-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Phospholipase C-eta-1, phospholipase C, eta 1, Phospholipase C like protein 3, Phosphoinositide phospholipase C-eta-1, EC:3.1.4.11

• 

  WB analysis using 19143-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19143-1-AP (PLCH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 19143-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 19143-1-AP (PLCH1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 19143-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 19143-1-AP (PLCH1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 19143-1-AP

  Immunofluorescent analysis of Hela cells, using PLCH1 antibody 19143-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 19143-1-AP

  Immunofluorescent analysis of HepG2 cells, using PLCH1 antibody 19143-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SH-SY5Y cells
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19143-1-AP targets PLCH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13607

  Product name: Recombinant human PLCH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1273-1655 aa of BC113950

  Sequence: SRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGESSLVEIDGESENLSLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQSSAQDMHVPVPKQLAHLPLPALKLPSPCKSKSLGDLTSEDIACNFESKYQCISKSFVTTGIRDKKGVTVKTKSLEPIDALTEQLRKLVSFDQEDNCQVLYSKQDANQLPRALVRKLSSRSQSRVRNIASRAKEKQEANKQKVPNPSNGAGVVLRNKPSAPTPAVNRHSTGSYIAGYLKNTKGGGLEGRGIPEGACTALHYGHVDQFCSDNSVLQTEPSSDDKPEIYFLLRL

• Full Name: phospholipase C, eta 1
• Calculated Molecular Weight: 1655 aa, 185 kDa
• Observed Molecular Weight: 185 kDa
• GenBank Accession Number: BC113950
• Gene Symbol: PLCH1
• Gene ID (NCBI): 23007
• RRID: AB_10643386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4KWH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Exp Mol Med; Role of phospholipase Cη1 in lateral habenula astrocytes in depressive-like behavior in mice; Authors - Sukwoon Song
human	WB	Front Immunol; Identification of nine signature proteins involved in periodontitis by integrated analysis of TMT proteomics and transcriptomics; Authors - Wei Liu