PLCH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLCH1 Polyclonal antibody, PBS Only (19143-1-PBS)

• 

  WB analysis using 19143-1-AP (same clone as 19143-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19143-1-AP (PLCH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19143-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 19143-1-AP (same clone as 19143-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 19143-1-AP (PLCH1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 19143-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 19143-1-AP (same clone as 19143-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 19143-1-AP (PLCH1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 19143-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 19143-1-AP (same clone as 19143-1-PBS)

  Immunofluorescent analysis of Hela cells, using PLCH1 antibody 19143-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 19143-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 19143-1-AP (same clone as 19143-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using PLCH1 antibody 19143-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 19143-1-PBS in a different storage buffer formulation.

PLCH1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19143-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

19143-1-PBS targets PLCH1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13607

  Product name: Recombinant human PLCH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1273-1655 aa of BC113950

  Sequence: SRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGESSLVEIDGESENLSLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQSSAQDMHVPVPKQLAHLPLPALKLPSPCKSKSLGDLTSEDIACNFESKYQCISKSFVTTGIRDKKGVTVKTKSLEPIDALTEQLRKLVSFDQEDNCQVLYSKQDANQLPRALVRKLSSRSQSRVRNIASRAKEKQEANKQKVPNPSNGAGVVLRNKPSAPTPAVNRHSTGSYIAGYLKNTKGGGLEGRGIPEGACTALHYGHVDQFCSDNSVLQTEPSSDDKPEIYFLLRL

• Full Name: phospholipase C, eta 1
• Calculated Molecular Weight: 1655 aa, 185 kDa
• Observed Molecular Weight: 185 kDa
• GenBank Accession Number: BC113950
• Gene Symbol: PLCH1
• Gene ID (NCBI): 23007
• RRID: AB_10643386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4KWH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.