PLDN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLDN Polyclonal antibody (10891-2-AP)

• Featured Product
• KD/KO Validated

PLDN Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10891-2-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

BLOC1S6, PA, PALLID, Pallid protein homolog, Pallidin, pallidin homolog (mouse), PLDN

• 

  WB analysis using 10891-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10891-2-AP (PLDN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10891-2-AP

  WB result of PLDN antibody (10891-2-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PLDN transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 10891-2-AP

  IP result of anti-PLDN (IP:10891-2-AP, 3ug; Detection:10891-2-AP 1:500) with K-562 cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10891-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10891-2-AP (PLDN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10891-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10891-2-AP (PLDN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLDN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10891-2-AP targets PLDN in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1337

  Product name: Recombinant human PLDN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC004819

  Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

• Full Name: pallidin homolog (mouse)
• Calculated Molecular Weight: 23~24 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC004819
• Gene Symbol: PLDN
• Gene ID (NCBI): 26258
• RRID: AB_2164174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion. Pallidin is a 25 kDa subunit of the octamer BLOC-1.

Publications

What published studies show

The PLDN Polyclonal antibody (Cat# 10891-2-AP) has 21 citations published in journals including Nature Communications, Developmental Cell, Current Biology, Journal of Cell Biology, Journal of Neuroscience, Molecular Biology of the Cell, eLife, and others. Research fields span BLOC-1 complex function, endosomal/lysosomal trafficking, synaptic vesicle biogenesis, Hermansky-Pudlak syndrome, schizophrenia-related dysbindin pathways, platelet dense granule formation, autophagy, and immune defense mechanisms.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Loss of the batten disease protein CLN3 leads to mis-trafficking of M6PR and defective autophagic-lysosomal reformation; Authors - Alessia Calcagni'
human	WB	Dev Cell; BORC, a Multisubunit Complex that Regulates Lysosome Positioning.; Authors - Jing Pu
human	WB,IF	Curr Biol; BLOC-1 Brings Together the Actin and Microtubule Cytoskeletons to Generate Recycling Endosomes.; Authors - Cédric Delevoye ; KD Validated
human	WB	J Cell Biol; PI4P and BLOC-1 remodel endosomal membranes into tubules; Authors - Riddhi Atul Jani
mouse	WB	Cells; Dysbindin deficiency Alters Cardiac BLOC-1 Complex and Myozap Levels in Mice.; Authors - Ankush Borlepawar
mouse	WB	Am J Respir Cell Mol Biol; Gene-edited MLE-15 Cells as a Model for the Hermansky Pudlak Syndromes.; Authors - Seunghyi Kook ; KO Validated