PLDN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLDN Polyclonal antibody, PBS Only (10891-2-PBS)

• 

  WB analysis using 10891-2-AP (same clone as 10891-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10891-2-AP (PLDN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10891-2-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 10891-2-AP (same clone as 10891-2-PBS)

  WB result of PLDN antibody (10891-2-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PLDN transfected A431 cells. This data was developed using the same antibody clone with 10891-2-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 10891-2-AP (same clone as 10891-2-PBS)

  IP result of anti-PLDN (IP:10891-2-AP, 3ug; Detection:10891-2-AP 1:500) with K-562 cells lysate 3600ug. This data was developed using the same antibody clone with 10891-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10891-2-AP (same clone as 10891-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10891-2-AP (PLDN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10891-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10891-2-AP (same clone as 10891-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10891-2-AP (PLDN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10891-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PLDN Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10891-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

10891-2-PBS targets PLDN in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1337

  Product name: Recombinant human PLDN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC004819

  Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

• Full Name: pallidin homolog (mouse)
• Calculated Molecular Weight: 23~24 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC004819
• Gene Symbol: PLDN
• Gene ID (NCBI): 26258
• RRID: AB_2164174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL45
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion. Pallidin is a 25 kDa subunit of the octamer BLOC-1.