PLEKHA1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PLEKHA1 Recombinant monoclonal antibody, PBS Only (88114-1-PBS)

PLEKHA1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88114-1-PBS

Clone No.260319B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PH domain-containing family A member 1, Pleckstrin homology domain-containing family A member 1, Tandem PH domain-containing protein 1, TAPP 1, TAPP1

• 

  WB analysis using 88114-1-RR (same clone as 88114-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88114-1-RR (PLEKHA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88114-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88114-1-PBS targets PLEKHA1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0318

  Product name: Recombinant human PLEKHA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC001136

  Sequence: MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVI

• Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC001136
• Gene Symbol: PLEKHA1
• Gene ID (NCBI): 59338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HB21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pleckstrin homology (PH) domain is commonly found in eukaryotic signaling proteins and possesses multiple functions including the abilities to bind inositol phosphates and various proteins. The tandem PH domain containing protein-1 (TAPP1) or PH domain containing-family A (phosphoinositide binding specific) member 1 (PLEKHA1), interacts strongly and specifically with phosphatidylinositol 3,4-trisphosphate [PtdIns(3,4)P(2)], which is one of the immediate breakdown products of PtdIns(3,4,5) P (3) and functions as a signalling molecule in insulin- and growth-factor-stimulated pathways. TAPP1 is also associated with the protein-tyrosine-phosphatase-like protein-1 (PTPL1 also known as FAP-1) and maintains PTPL1 in cytoplasm. By binding to PtdIns(3,4) P (2) and PTPL1, TAPP1 may regulate the membrane localization of PTPL1.