PLEKHA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLEKHA3 Polyclonal antibody, PBS Only (11292-1-PBS)

• 

  WB analysis using 11292-1-AP (same clone as 11292-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11292-1-AP (PLEKHA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11292-1-PBS in a different storage buffer formulation.

PLEKHA3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11292-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11292-1-PBS targets PLEKHA3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1851

  Product name: Recombinant human PLEKHA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC044567

  Sequence: MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS

• Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC044567
• Gene Symbol: PLEKHA3
• Gene ID (NCBI): 65977
• RRID: AB_10637846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.