PLEKHF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLEKHF2 Polyclonal antibody, PBS Only (25424-1-PBS)

• 

  WB analysis using 25424-1-AP (same clone as 25424-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25424-1-AP (PLEKHF2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 25424-1-AP (same clone as 25424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 25424-1-AP (PLEKHF2 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brown adipose using 25424-1-AP (same clone as 25424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brown adipose tissue slide using 25424-1-AP (PLEKHF2 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brown adipose using 25424-1-AP (same clone as 25424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brown adipose tissue slide using 25424-1-AP (PLEKHF2 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brown adipose using 25424-1-AP (same clone as 25424-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using PLEKHF2 antibody (25424-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brown adipose using 25424-1-AP (same clone as 25424-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using PLEKHF2 antibody (25424-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25424-1-PBS in a different storage buffer formulation.

PLEKHF2 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 25424-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Phafin 2, PHAFIN2, ZFYVE18

---

Product Information

25424-1-PBS targets PLEKHF2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22285

  Product name: Recombinant human PLEKHF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 186-249 aa of BC011806

  Sequence: CSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD

• Full Name: pleckstrin homology domain containing, family F (with FYVE domain) member 2
• Calculated Molecular Weight: 249 aa, 28 kDa
• Observed Molecular Weight: 22-27 kDa
• GenBank Accession Number: BC011806
• Gene Symbol: PLEKHF2
• Gene ID (NCBI): 79666
• RRID: AB_3669474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8W4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phafin2 is a lysosomal protein consisting of 249 amino acids with a unique structure containing both an N-terminal PH (pleckstrin homology) domain and C terminal FYVE (Fab 1, YOTB, Vac 1, and EEA1) domain.