PLEKHH2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human kidney using 86166-3-RR (same clone as 86166-3-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 86166-3-RR (PLEKHH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86166-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86166-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86166-3-RR against Human PLEKHH2 were performed. The affinity constant is 6.03 nM.

PLEKHH2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86166-3-PBS

Clone No.250291H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

KIAA2028, Pleckstrin homology domain-containing family H member 2, PLEKHH1L

---

Product Information

86166-3-PBS targets PLEKHH2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5409

  Product name: Recombinant human PLEKHH2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-357 aa of BC063310

  Sequence: MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAFQQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEAKIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDNQVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKSRCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQE

• Full Name: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2
• Calculated Molecular Weight: 168 kDa
• Observed Molecular Weight: 168 kDa
• GenBank Accession Number: BC063310
• Gene Symbol: PLEKHH2
• Gene ID (NCBI): 130271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IVE3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLEKHH2 is a 1491-residue intracellular protein highly enriched in renal glomerular podocytes. PLEKHH2 is one of two previously uncharacterized PLEKHH proteins encoded in the mammalian genomes. A PLEKHH ortholog has also been described in Drosophila, Caenorhabditis elegans, and zebrafish. In C. elegans, the loss of the protein was found to cause variable axon guidance defects.