PM20D1 Recombinant monoclonal antibody, PBS Only (Detector)

PM20D1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84397-2-PBS
Clone No.241557E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

241557E1, EC:3.5.1.114, N-fatty-acyl-amino acid synthase/hydrolase PM20D1, Peptidase M20 domain-containing protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84397-2-PBS targets PM20D1 as part of a matched antibody pair:

MP01268-1: 84397-1-PBS capture and 84397-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29154

Product name: Recombinant human PM20D1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-202 aa of BC063477

Sequence: TVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGVIYGWGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRIS

Predict reactive species
Full Name peptidase M20 domain containing 1
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC063477
Gene Symbol PM20D1
Gene ID (NCBI) 148811
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6GTS8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PM20D1 is a secreted enzyme that regulates the endogenous N-fatty acyl amino acid (NAAs) tissue and circulating levels by functioning as a bidirectional NAA synthase/hydrolase (PMID: 27374330).

Loading...
||
New chat

Able

正在加载,请稍候...