PMM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PMM2 Polyclonal antibody (10666-1-AP)

• Featured Product
• KD/KO Validated

PMM2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10666-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:5.4.2.8, phosphomannomutase 2

• 

  WB analysis using 10666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of multi-tissue using 10666-1-AP

  WB results of 10666-1-AP (PMM2 antibody) on several lysates.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10666-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10666-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 10666-1-AP

  IP result of anti-PMM2 (IP:10666-1-AP, 4ug; Detection:10666-1-AP 1:1000) with mouse lung tissue lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10666-1-AP (PMM2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10666-1-AP (PMM2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 10666-1-AP (PMM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10666-1-AP (PMM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10666-1-AP (PMM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 10666-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10666-1-AP (PMM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10666-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PMM2 antibody (10666-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PMM2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse liver tissue, multi-tissue, HepG2 cellls, mouse testis tissue, rat kidney tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human breast cancer tissue, human stomach cancer tissue, rat stomach tissue, mouse stomach tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10666-1-AP targets PMM2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1031

  Product name: Recombinant human PMM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC008310

  Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

• Full Name: phosphomannomutase 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC008310
• Gene Symbol: PMM2
• Gene ID (NCBI): 5373
• RRID: AB_2166973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15305
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PMM2(Phosphomannomutase 2) belongs to the eukaryotic PMM family. It is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. PMM2 catalyzes the second step in the conversion of fructose-6P to GDP-mannose.

Publications

What published studies show

The PMM2 polyclonal antibody (Cat# 10666-1-AP) has accumulated 17 citations published in journals including Oncogene, Frontiers in Immunology, Gene Therapy, Molecular Genetics & Metabolism, PLoS ONE, Human Mutation, Journal of Proteome Research, and Biology Open. Associated research fields encompass congenital disorders of glycosylation (PMM2-CDG), colorectal cancer, neurodegeneration, glycosylation metabolism, gene therapy, immunopathology, and endothelial barrier function.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IHC,CoIP	Oncogene; PMM2 interacts with TRIM28 to recruit E2F4 and promote KIFC3-mediated tumor glycolysis and colorectal cancer progression.; Authors - Zheng Peng ; KD Validated
human	WB	Front Immunol; Immunopathology in PMM2-CDG: Defective glycosylation impact in the TNFα -TNFR1 signalling pathway.; Authors - Carlota Pascoal
mouse	WB	Gene Ther; AAV-based gene replacement therapy prevents and halts manifestation of abnormal neurological phenotypes in a novel mouse model of PMM2-CDG; Authors - Mian-Ling Zhong ; KO Validated
human	WB	Thromb Haemost; N-Glycosylation Deficiency Reduces the Activation of Protein C and Disrupts Endothelial Barrier Integrity; Authors - Tiffany Pascreau ; KD Validated
	WB	Biochim Biophys Acta Mol Cell Res; Beneficial effects of Glc-1,6-P2 modulation on mutant phosphomannomutase-2; Authors - Maria Monticelli
human	IHC	Funct Integr Genomics; Exploring the glycolytic cross-talk genes between inflammatory bowel disease and colorectal cancer; Authors - Chenglin Ye