PMP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PMP2 Polyclonal antibody, PBS Only (12717-1-PBS)

• 

  WB analysis using 12717-1-AP (same clone as 12717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12717-1-AP (PMP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12717-1-AP (same clone as 12717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12717-1-AP (PMP2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12717-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PMP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12717-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

FABP8, M-FABP, Myelin P2 protein

---

Product Information

12717-1-PBS targets PMP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3411

  Product name: Recombinant human PMP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC034997

  Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

• Full Name: peripheral myelin protein 2
• Calculated Molecular Weight: 132 aa, 15 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC034997
• Gene Symbol: PMP2
• Gene ID (NCBI): 5375
• RRID: AB_2166978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02689
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.