PMVK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PMVK Polyclonal antibody, PBS Only (15674-1-PBS)

• 

  WB analysis using 15674-1-AP (same clone as 15674-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15674-1-AP (PMVK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15674-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15674-1-AP (same clone as 15674-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15674-1-AP (PMVK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15674-1-AP (same clone as 15674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15674-1-AP (PMVK Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15674-1-AP (same clone as 15674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15674-1-AP (PMVK Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15674-1-PBS in a different storage buffer formulation.

PMVK Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15674-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15674-1-PBS targets PMVK in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8141

  Product name: Recombinant human PMVK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC007694

  Sequence: MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

• Full Name: phosphomevalonate kinase
• Calculated Molecular Weight: 192 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC007694
• Gene Symbol: PMVK
• Gene ID (NCBI): 10654
• RRID: AB_2299910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15126
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.