Tested Applications
| Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
| Positive IHC detected in | human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26218-1-AP targets PNLIPRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23967 Product name: Recombinant human PNLIPRP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 425-469 aa of BC005989 Sequence: RGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC Predict reactive species |
| Full Name | pancreatic lipase-related protein 2 |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC005989 |
| Gene Symbol | PNLIPRP2 |
| Gene ID (NCBI) | 5408 |
| RRID | AB_2880430 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54317 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pancreatic lipase-related proteins 1 and 2 (PNLIPRP1 and PNLIPRP2) are highly conserved paralogs within the classic neutral lipase family. Despite structural similarities to canonical pancreatic triglyceride lipase, their catalytic activities diverge drastically. PNLIPRP2 possesses broad-spectrum lipolytic capabilities, digesting galactolipids and phospholipids, which is essential for neonatal milk consumption. Conversely, PNLIPRP1 lacks detectable lipolytic activity against known substrates but functions in human metabolic regulation and exocrine homeostasis.(PMID: 1379598; PMID: 34290745; PMID: 39137110)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PNLIPRP2 antibody 26218-1-AP | Download protocol |
| WB protocol for PNLIPRP2 antibody 26218-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
