PNRC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PNRC1 Polyclonal antibody, PBS Only (51052-1-PBS)

• 

  WB analysis of Raji using 51052-1-AP (same clone as 51052-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 51052-1-AP (PNRC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51052-1-PBS in a different storage buffer formulation.

PNRC1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 51052-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

51052-1-PBS targets PNRC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0100

  Product name: Recombinant human PNRC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 54-242 aa of BC018112

  Sequence: TLFLPHFLGGDGPCLTPQPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSS

• Full Name: proline-rich nuclear receptor coactivator 1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC018112
• Gene Symbol: PNRC1
• Gene ID (NCBI): 10957
• RRID: AB_2299805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12796
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.