POLE2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLE2 Polyclonal antibody (33482-1-AP)

• 

  WB analysis using 33482-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33482-1-AP (POLE2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 33482-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using POLE2 antibody (33482-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

POLE2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33482-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

DNA polymerase epsilon subunit 2, DNA polymerase epsilon subunit B, DNA polymerase II subunit 2, DPE2

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33482-1-AP targets POLE2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38070

  Product name: Recombinant human POLE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-527 aa of BC126218

  Sequence: IGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEVLEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIICEYPDIHQSSRFVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLVNKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTTTNTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF

• Full Name: polymerase (DNA directed), epsilon 2 (p59 subunit)
• Calculated Molecular Weight: 527 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC126218
• Gene Symbol: POLE2
• Gene ID (NCBI): 5427
• RRID: AB_3742987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P56282
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA polymerase epsilon subunit 2 (POLE2) is involved in cellular functions such as DNA replication, repair, and cell cycle control, as well as in the array-based proliferative signatures (PMID: 9745046; 12620412). Knockdown of POLE2 could suppress esophageal squamous cell carcinoma development through regulating cell proliferation, apoptosis, and migration (PMID: 32831648). POLE2 can also regulate the development of oral squamous cell carcinoma by inhibiting the PI3K/AKT signaling pathway (PMID: 38079056).