POLG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLG Polyclonal antibody (14110-1-AP)

• KD/KO Validated

POLG Polyclonal Antibody for WB, ELISA

Cat No. 14110-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

3'-5' exodeoxyribonuclease, 5'-deoxyribose-phosphate lyase, DNA polymerase subunit gamma-1, EC:2.7.7.7, EC:3.1.11.-

• 

  WB analysis using 14110-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14110-1-AP (POLG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 14110-1-AP

  WB result of POLG antibody (14110-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-POLG transfected HEK-293T cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for POLG in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293T cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14110-1-AP targets POLG in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5256

  Product name: Recombinant human POLG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 888-1239 aa of BC042571

  Sequence: GADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

• Full Name: polymerase (DNA directed), gamma
• Calculated Molecular Weight: 140 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC042571
• Gene Symbol: POLG
• Gene ID (NCBI): 5428
• RRID: AB_3669178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54098
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POLG is the catalytic subunit of DNA polymerase gamma solely responsible for the replication of mitochondrial DNA (mtDNA). POLG replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers, and the four deoxyribonucleoside triphosphates as substrates (PMID:11477093; 11897778; 15917273; 19837034; 9558343).

Publications

What published studies show

The POLG polyclonal antibody (Cat# 14110-1-AP) has 1 citation. It appears in Cancer Gene Ther (IF 6.4), in a study titled "MSTO1 modulates RAD51 activity to safeguard mitochondrial DNA integrity and control immune responses." The research field encompasses mitochondrial DNA maintenance, DNA repair mechanisms (RAD51), immune regulation, and cancer gene therapy.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Gene Ther; MSTO1 modulates RAD51 activity to safeguard mitochondrial DNA integrity and control immune responses.; Authors - Kaiqi Cheng