POLG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLG2 Polyclonal antibody, PBS Only (10997-2-PBS)

• 

  WB analysis of COLO 320 using 10997-2-AP (same clone as 10997-2-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10997-2-AP (POLG2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10997-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10997-2-AP (same clone as 10997-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10997-2-AP (POLG2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10997-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 10997-2-AP (same clone as 10997-2-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 10997-2-AP (POLG2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10997-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10997-2-AP (same clone as 10997-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10997-2-AP (POLG2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10997-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 10997-2-AP (same clone as 10997-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using POLG2 antibody (10997-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10997-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

POLG2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10997-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DNA polymerase subunit gamma-2, MTPOLB, p55, PEOA4, POLGB

---

Product Information

10997-2-PBS targets POLG2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1424

  Product name: Recombinant human POLG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 136-485 aa of BC009194

  Sequence: GPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV

• Full Name: polymerase (DNA directed), gamma 2, accessory subunit
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC009194
• Gene Symbol: POLG2
• Gene ID (NCBI): 11232
• RRID: AB_2299887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHN1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

mtDNA is replicated by DNA polymerase gamma, which is composed of a catalytic (encoded by POLG) and an accessory subunit (encoded by POLG2). POLG2(DNA polymerase subunit gamma-2, mitochondrial) can stimulate the polymerase and exonuclease activities (PMID: 37085601). Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) (PMID: 16685652).Western blot result suggested that the POLG2 expressed in human fetal kidney and U-251 MG cell lines with a single band of 55kd.