POLR1E Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLR1E Polyclonal antibody (16145-1-AP)

• Featured Product
• KD/KO Validated

POLR1E Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16145-1-AP Copied!

Publications (9)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

A49, DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, PAF53, POLR

• 

  WB analysis using 16145-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16145-1-AP (POLR1E antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16145-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16145-1-AP (POLR1E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 16145-1-AP

  WB result of POLR1E antibody (16145-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-POLR1E transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 16145-1-AP

  IP result of anti-POLR1E (IP:16145-1-AP, 4ug; Detection:16145-1-AP 1:3000) with HepG2 cells lysate 1600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16145-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16145-1-AP (POLR1E Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for POLR1E in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, MCF-7 cells, Jurkat cells, L02 cells, MDA-MB-231 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16145-1-AP targets POLR1E in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9269

  Product name: Recombinant human POLR1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-419 aa of BC014331

  Sequence: AELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRKVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT

• Full Name: polymerase (RNA) I polypeptide E, 53kDa
• Calculated Molecular Weight: 481aa,54 kDa; 419aa,47 kDa
• Observed Molecular Weight: 47-53 kDa
• GenBank Accession Number: BC014331
• Gene Symbol: POLR1E
• Gene ID (NCBI): 64425
• RRID: AB_2167341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZS1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The antibody (catalog #16145-1-AP) targets the RNA Polymerase I catalytic subunit. It has 9 total citations published in journals including Science, J Biol Chem (×3), Int J Biol Macromol, Mol Biol Cell, PLoS One, Cancer Invest, and Biol Reprod. Research fields span Pol I transcription regulation, rDNA processing, nucleolar dynamics, mitosis, cancer/leukemia, and oocyte development. Applications cited include WB, IF, and ChIP.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	ChIP	Science; lncRNA SLERT controls phase separation of FC/DFCs to facilitate Pol I transcription.; Authors - Man Wu
human	WB,IF	Int J Biol Macromol; Silencing of human RNA polymerase I subunit A34 influences multiple cellular processes including rDNA transcription and cell migration.; Authors - Xiaoye Song
human	WB,IF	J Biol Chem; PAF49: An RNA Polymerase I subunit essential for rDNA transcription and stabilization of PAF53; Authors - Rachel McNamar
human	WB	J Biol Chem; Identification of an E3 ligase that targets the catalytic subunit of RNA polymerase I upon transcription stress; Authors - Stephanie Pitts
	WB	J Biol Chem; Conditional depletion of the RNA polymerase I subunit PAF53 reveals that it is essential for mitosis and enables identification of functional domains.; Authors - Rachel McNamar
human	IF	Mol Biol Cell; Nucleoli and the nucleoli-centromere association are dynamic during normal development and in cancer; Authors - Aaron Rodrigues

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product reports a 5-star rating for Western Blot. The user observed a clear single band with a very strong signal at a 1:1000 dilution in B cell lines, and noted the result changed as expected following proteomics treatment. Overall, the feedback highlights strong specificity and signal intensity.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Annabel (Verified Customer) (02-12-2026)

Clear single band and very strong signal, changed as expected from proteomics

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: B Cell lines