POLR1E Polyclonal antibody

• 

  WB analysis using 16145-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16145-1-AP (POLR1E antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16145-1-AP

  WB result of POLR1E antibody (16145-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-POLR1E transfected MCF-7 cells.

• 

  WB analysis of human brain using 16145-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16145-1-AP (POLR1E antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16145-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16145-1-AP (POLR1E antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 16145-1-AP

  IP result of anti-POLR1E (IP:16145-1-AP, 3ug; Detection:16145-1-AP 1:500) with Jurkat cells lysate 1000ug.

• 

  IHC staining of human liver cancer using 16145-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16145-1-AP (POLR1E Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

POLR1E Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16145-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ChIP, ELISA

Synonyms

PAF53, POLR1E, PRAF1, RNA polymerase I subunit A49, RP11 405L18.3

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, Jurkat cells, MCF-7 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 3 publications below
• ChIP: See 1 publications below

Product Information

16145-1-AP targets POLR1E in WB, IP, IF, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9269

  Product name: Recombinant human POLR1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-419 aa of BC014331

  Sequence: AELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRKVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT

• Full Name: polymerase (RNA) I polypeptide E, 53kDa
• Calculated Molecular Weight: 481aa,54 kDa; 419aa,47 kDa
• Observed Molecular Weight: 47-53 kDa
• GenBank Accession Number: BC014331
• Gene Symbol: POLR1E
• Gene ID (NCBI): 64425
• RRID: AB_2167341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZS1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	ChIP	Science; lncRNA SLERT controls phase separation of FC/DFCs to facilitate Pol I transcription.; Authors - Man Wu
human	WB	J Biol Chem; Identification of an E3 ligase that targets the catalytic subunit of RNA polymerase I upon transcription stress; Authors - Stephanie Pitts
	WB	J Biol Chem; Conditional depletion of the RNA polymerase I subunit PAF53 reveals that it is essential for mitosis and enables identification of functional domains.; Authors - Rachel McNamar
human	WB	Cancer Invest; Quinacrine Depletes BCR-ABL and Suppresses Ph-Positive Leukemia Cells; Authors - Hu Lei
human	IF	PLoS One; Expression of RNA polymerase I catalytic core is influenced by RPA12; Authors - Brittany L Ford
human	IF	Mol Biol Cell; Nucleoli and the nucleoli-centromere association are dynamic during normal development and in cancer; Authors - Aaron Rodrigues