POLR2C Polyclonal antibody

• 

  WB analysis of mouse kidney using 13428-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13428-1-AP (POLR2C Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13428-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13428-1-AP (POLR2C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 13428-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13428-1-AP (POLR2C Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 13428-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13428-1-AP (POLR2C Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13428-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13428-1-AP (POLR2C Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 13428-1-AP

  IP result of anti-POLR2C (IP:13428-1-AP, 4ug; Detection:13428-1-AP 1:500) with HeLa cells lysate 2000ug.

• 

  IHC staining of human cervical cancer using 13428-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 13428-1-AP (POLR2C antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cervical cancer using 13428-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 13428-1-AP (POLR2C antibody) at dilution of 1:100 (under 40x lens).

POLR2C Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13428-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

hRPB33, hsRPB3, POLR2C, RNA polymerase II subunit 3, RNA polymerase II subunit B3, RPB3, RPB31, RPB33

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

13428-1-AP targets POLR2C in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4228

  Product name: Recombinant human POLR2C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 58-275 aa of BC028157

  Sequence: VLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

• Full Name: polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
• Calculated Molecular Weight: 275 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC028157
• Gene Symbol: POLR2C
• Gene ID (NCBI): 5432
• RRID: AB_2167653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19387
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; RNA Pol II preferentially regulates ribosomal protein expression by trapping disassociated subunits; Authors - Yuanjun Li
mouse	WB	Mol Cell; Targeted protein degradation reveals RNA Pol II heterogeneity and functional diversity; Authors - Yuanjun Li
human	WB	Biomed Microdevices; Incorporation of VSV-G produces fusogenic plasma membrane vesicles capable of efficient transfer of bioactive macromolecules and mitochondria.; Authors - Hao-Peng Lin
mouse		Genome Biol; Cross-regulome profiling of RNA polymerases highlights the regulatory role of polymerase III on mRNA transcription by maintaining local chromatin architecture; Authors - Yongpeng Jiang