POLR2H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLR2H Polyclonal antibody (15086-1-AP)

POLR2H Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15086-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RPABC3, hsRPB8, hRPB8, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide

• 

  WB analysis of HL-60 using 15086-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15086-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 15086-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 15086-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15086-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15086-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15086-1-AP (POLR2H antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 15086-1-AP

  IP result of anti-POLR2H (IP:15086-1-AP, 4ug; Detection:15086-1-AP 1:500) with mouse liver tissue lysate 6000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15086-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 15086-1-AP (POLR2H antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15086-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 15086-1-AP (POLR2H antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15086-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 15086-1-AP (POLR2H antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse kidney tissue, HeLa cells, MCF-7 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15086-1-AP targets POLR2H in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7166

  Product name: Recombinant human POLR2H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC000739

  Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

• Full Name: polymerase (RNA) II (DNA directed) polypeptide H
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC000739
• Gene Symbol: POLR2H
• Gene ID (NCBI): 5437
• RRID: AB_2167826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52434
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POLR2H, also known as hRPB8, is a 150 amino acid protein, which localizes in nucleolus and is expressed in 228 organ(s), highest expression level in mucosa of transverse colon. POLR2H. POLR2H is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR2H is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; Targeted protein degradation reveals RNA Pol II heterogeneity and functional diversity; Authors - Yuanjun Li
human	IHC	Oncol Lett; Identification of the key genes and pathways in prostate cancer.; Authors - Shutong Fan
human	WB	Mol Cell; Divergent proteome tolerance against gain and loss of chromosome arms.; Authors - Yi Di
mouse		Genome Biol; Cross-regulome profiling of RNA polymerases highlights the regulatory role of polymerase III on mRNA transcription by maintaining local chromatin architecture; Authors - Yongpeng Jiang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Yuan (Verified Customer) (12-13-2019)

Worked for human Hela cell. Nice staining at nucleoli area.

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:50
• Cell Tissue Type: Hela cell