POLR3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLR3B Polyclonal antibody, PBS Only (16574-1-PBS)

• 

  WB analysis of HepG2 using 16574-1-AP (same clone as 16574-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16574-1-AP (POLR3B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16574-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16574-1-AP (same clone as 16574-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16574-1-AP (POLR3B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16574-1-PBS in a different storage buffer formulation.

POLR3B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16574-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16574-1-PBS targets POLR3B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9856

  Product name: Recombinant human POLR3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 794-1133 aa of BC046238

  Sequence: MLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLSKYNE

• Full Name: polymerase (RNA) III (DNA directed) polypeptide B
• Calculated Molecular Weight: 1133 aa, 128 kDa
• Observed Molecular Weight: 128 kDa
• GenBank Accession Number: BC046238
• Gene Symbol: POLR3B
• Gene ID (NCBI): 55703
• RRID: AB_2168001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NW08
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.